If you have been reading about Epithalamin and want a single page that covers the useful parts, this is it: definitions, context, how it is studied, and the questions that come up repeatedly.
Last reviewed on 2025-08-15. Where a claim depends on a specific study, the study is described rather than over-claimed.
Several names circulate for the same molecule, including epitalon, epithalone, epithalamin tetrapeptide, and the sequence code AEDG. A CAS registry number, 307297-39-8, is commonly cited for it, though catalogue entries should be checked against supplier documentation because mislabelled records occur. In its usual form the peptide carries free amino and carboxyl termini and is neither glycosylated nor lipidated. Researchers distinguish the defined tetrapeptide from epithalamin itself, a crude pineal preparation containing many peptides that is not chemically characterised.
Material supplied for laboratory use is normally a lyophilised white to off-white powder that dissolves readily in water and in isotonic saline. Lyophilised cakes are hygroscopic and should be equilibrated to room temperature before opening to limit condensation on the solid. Solutions are typically prepared at milligram-per-millilitre concentrations and divided into single-use aliquots, because repeated freeze–thaw cycles degrade short peptides. Aqueous solutions are far less stable than the dry powder, and identity is usually verified by mass spectrometry alongside purity estimation from reversed-phase high-performance liquid chromatography.
Epitalon is a synthetic linear tetrapeptide with the sequence alanine–glutamate–aspartate–glycine, abbreviated AEDG. Its molecular formula is C14H22N4O9 and the calculated mass is approximately 390.35 g/mol. The compound is made by solid-phase peptide synthesis rather than extracted from tissue, although early work described it as a short fragment of a peptide fraction obtained from bovine pineal extract. In the research literature the spelling epitalon and the variant epithalone both appear, while AEDG is the standard code used in peptide nomenclature.
The proposed relationship between epitalon and pineal function is a central part of its background. Khavinson's group reported that short peptides corresponding to regions of larger pineal proteins could influence gene expression in cells. Epitalon was framed as a synthetic analogue of an active fragment rather than a direct isolation product. Whether the tetrapeptide reproduces the effects of the parent extract is an open question, because comparative studies are limited and the parent extract itself is not a single defined substance.
Interest in epitalon is usually discussed within the broader field of short peptide bioregulators, a category that includes other synthetic di-, tri-, and tetrapeptides studied by the same research group. These compounds share a common rationale: that small fragments of tissue-derived proteins can retain biological activity and can be produced reproducibly. The category as a whole remains outside mainstream pharmacological consensus, and epitalon specifically has a limited presence in independent, non-Russian research literature, which shapes how its evidence base is described.
Epitalon is a synthetic tetrapeptide with the amino acid sequence alanine-glutamate-aspartate-glycine, abbreviated Ala-Glu-Asp-Gly or AEDG. It was developed by the Russian researcher Vladimir Khavinson and colleagues during work on peptide bioregulators derived from the pineal gland. The compound is short enough to be produced by standard solid-phase peptide synthesis and is typically handled as a lyophilized white powder. Its small size distinguishes it from larger pineal peptides such as epithalamin, a complex extract from which the tetrapeptide was conceptually derived.
| Property | Value | Notes |
|---|---|---|
| Amino acid sequence | Ala-Glu-Asp-Gly | Linear tetrapeptide, also written AEDG |
| Molecular mass | About 390.35 g/mol | Value calculated from the sequence |
| Appearance | White to off-white powder | Lyophilised material forms a loose cake |
| Solubility | Freely soluble in water | Also dissolves in isotonic saline |
| Storage | -20 °C, desiccated | Aliquot solutions to avoid freeze–thaw cycling |
Proposed mechanisms centre on cell-culture observations rather than a defined receptor interaction. Several reports describe increased expression of the telomerase catalytic subunit after exposure of cultured human cells, and the authors attributed the effect to short peptide fragments entering the nucleus and influencing gene transcription. No receptor for the tetrapeptide has been identified, and the free peptide is expected to be degraded rapidly by plasma peptidases. Whether any measurable fraction reaches intact tissues after administration remains an unresolved question rather than an established finding.
The published literature is dominated by a small number of research groups, much of it in Russian-language journals, and independent replication outside those groups is limited. Studies are typically small, use cultured cells or rodent models, and report endpoints that differ between papers, which makes comparison difficult. Large randomised human trials have not appeared in the indexed literature. Questions about absorption, distribution and clearance are therefore still treated as open in reviews that mention the compound.
Epitalon is a synthetic tetrapeptide whose sequence is alanine-glutamate-aspartate-glycine, written in single-letter code as AEDG. The four residues are joined by three peptide bonds, giving a linear backbone with no branching and no disulfide bridges. Its calculated molecular mass for the free form is approximately 390.3 daltons, a figure that rises when the compound is supplied as an acetate or trifluoroacetate salt. Because the chain is short, the molecule is defined entirely by its residue order rather than by any folded three-dimensional structure.
The compound is described in the literature as a derivative of epithalamin, a preparation obtained from bovine pineal tissue. Work on this peptide family was carried out mainly by a research group in Saint Petersburg beginning in the 1980s, and the substance was later registered for clinical use in Russia under the name Epitalon. Outside that region it is generally treated as a research chemical rather than an approved medicine. Statements about its biological activity rest on a relatively small number of studies, and independent replication remains limited.
The peptide emerged from research carried out in Saint Petersburg from the late 1980s onward, where investigators searched for shorter active fragments of a pineal preparation known as epithalamin. The name epitalon was chosen to reflect that parent extract. Early reports described effects on neuroendocrine markers and on the lifespan of laboratory animals. Much of that work appeared in Russian-language journals, with English translations following later, which affects how readily the original protocols can be assessed by outside groups.
Published studies on epitalon are dominated by a small number of research groups, and independent replication in other laboratories remains limited. Proposed mechanisms include activation of telomerase and modulation of melatonin rhythms, but the evidence for either rests mainly on cell cultures and animal models. Whether the peptide produces comparable effects in humans is an open question, and the absence of large controlled trials means the literature is best read as exploratory rather than settled.
Epitalon is a synthetic four-amino-acid peptide with the sequence alanine-glutamate-aspartate-glycine, commonly abbreviated AEDG. Its molecular formula is C14H22N4O9, and its calculated molar mass is approximately 390.35 grams per mole. The compound is a short fragment related to a peptide fraction isolated from bovine pineal gland extracts, and it is normally supplied as a lyophilised powder intended for laboratory research. It is not a registered pharmaceutical product in most countries.
The pia mater (Latin: tender mother) is a very delicate membrane. It is the meningeal envelope that firmly adheres to the surfaces of the brain and spinal cord, following all of the brain's contours (gyri and sulci). It is a very thin sheet of connective tissue that interfaces with the glial limitans superficialis but lacks capillaries itself.
== Chemistry == Grammotoxin is a 36 amino acid protein toxin, with the sequence Asp-Cys-Val-Arg-Phe-Trp-Gly-Lys-Cys-Ser-Gln-Thr-Ser-Asp-Cys-Cys-Pro-His-Leu-Ala-Cys-Lys-Ser-Lys-Trp-Pro-Arg-Asn-Ile-Cys-Val-Trp-Asp-Gly-Ser-Val (DCVRFWGKCSQTSDCCPHLACKSKWPRNICVWDGSV), and disulfide bridges between Cys2-Cys16, Cys9-Cys21 and Cys15-Cys30. It forms an inhibitor cystine knot motif, common in spider toxins. Its chemical formula is: C177H268N52O50S6 Grammotoxin can be purified from Grammostola spatulata venom by reverse phase high performance liquid chromatography.
KKXX and for some proteins XKXX is a target peptide motif located in the C terminus in the amino acid structure of a protein responsible for retrieval of endoplasmic reticulum (ER) membrane proteins to and from the Golgi apparatus. These ER membrane proteins are transmembrane proteins that are then embedded into the ER membrane after transport from the Golgi. This motif is exclusively cytoplasmic and interacts with the COPI protein complex to target the ER from the cis end of the Golgi apparatus by retrograde transport. The abbreviation KKXX is formed by the corresponding standard abbreviations for lysine (K) and any amino acid (X). This letter system was defined by the IUPAC and IUBMB in 1983, and is as follows:
== NP-Mode == A concentration of hydrogen gas is used such that it is just below the minimum required for ignition. A rubidium or cesium bead, which is mounted over the nozzle, ignites the hydrogen (by acting catalytically), and forms a cold plasma. Excitation of the alkali metal results in ejection of electrons, which in turn are detected as a current flow between an anode and cathode in the chamber. As nitrogen or phosphorus analytes exit the column, they cause a reduction in the work function of the metal bead, resulting in an increase in current. Since the alkali metal bead is consumed over time, it must be replaced regularly .
=== Strategic Alliances === Grifols has pursued public-private alliances around the world. In 2020, Grifols signed an agreement with Egypt’s National Service Projects Organization to establish Grifols Egypt for Plasma Derivatives, a joint venture building the first integrated platform for sourcing and producing plasma medicines in Africa and the Middle East. This was followed by a long-term agreement with Canadian Blood Services in 2022, to help accelerate immunoglobulin self-sufficiency in Canada. Grifols also sought to strengthen and enhance China’s healthcare system by entering into a strategic alliance with Haier Group in late 2023 to further develop the Chinese plasma market, building on a strategic alliance it had established with Shanghai RAAS, a leading Chinese company in the plasma-derivatives sector, in 2020. Between January and March 2024, short seller fund Gotham City Research published several reports questioning Grifols financial accounting. In January 2024, following the first of such reports, Grifols filed a lawsuit against the short seller for making “false and misleading statements”. In February 2024, Grifols rejected what it considered were Gotham's "malicious, false and misleading insinuations" that had the "sole objective of destabilising Grifols and causing doubts amongst institutional investors". In April 2024, Grifols announced it was bringing in independent directors to improve its governance.
Sources: en.wikipedia.org
fasting capillary blood glucose levels <5.5 mmol/L 1 hour postprandial capillary blood glucose levels <8.0 mmol/L 2-hour postprandial blood glucose levels <6.7 mmol/L Regular blood samples can be used to determine HbA1c levels, which give an idea of glucose control over a longer period. Research suggests a possible benefit of breastfeeding to reduce the risk of diabetes and related risks for both mother and child.
== Publications == Tongraar, A.; Liedl, K. R.; Rode, Bernd M. (1997);"Solvation of Ca2+ In Water Studied By Born-Oppenheimer Ab-Initio QM/MM Dynamics"; J. Phys. Chem. A 1997, 101(35), p. 6299-6309,DOI: 10.1021/jp970963t. Rode, Bernd M.; Schwenk, Christian F., Tongraar, Anan (2004); "Structure and Dynamics of Hydrated Ions - New Insights through Quantum Cechanical Simulation"; J. Mol. Liq. 2004, 110(1-3), pp. 105–122. DOI: 10.1016/j.molliq.2003.09.016. Hofer, Thomas; Pribil, Andreas; Randolf, Bernhard; Rode, Bernd M. (2005); "Structure and dynamics of solvated Sn(II) in aqueous solution - an ab initio QM/MM MD approach", J. Am. Chem. Soc. 2005, 127(41), p. 14231-14238. DOI:10.1021/ja052700f. Rode, Bernd M.; Schwenk, Christian; Hofer, Thomas; Randolf, Bernhard (2005); "Coordination and ligand exchange dynamics of solvated metal ions"; Coord. Chem. Rev. 2005, 249(24), pp. 2993-–3006. DOI: doi:10.1016/j.ccr.2005.03.032. Rode, Bernd M.; Hofer, Thomas (2006); "How to Access Structure and Dynamics of Solutions: The Capabilities of Computational Methods", Pure Appl. Chem. 2006, 78(3), pp. 525–539. DOI: 10.1351/pac200678030525. Rode, Bernd M.; Hofer, Thomas; Randolf, Bernhard; Schwenk, Christian; Xenides, Demetrios; Vchirawongkwin, Viwat(2006); "Ab initio Quantum Mechanical Charge Field (QMCF) Molecular Dynamics - A QM/MM - MD Procedure for Accurate Simulations of Ions and Complexes"; Theor. Chem. Acc. 2006, 115(2-3), pp. 77–85. DOI: 10.1007/s00214-005-0049-1. Hofer, Thomas S.; Randolf, Bernhard R.; Rode, Bernd M.
Just like phagocytes, pathogens may evade or infect neutrophils. Some bacterial pathogens evolved various mechanisms such as virulence molecules to avoid being killed by neutrophils. These molecules collectively may alter or disrupt neutrophil recruitment, apoptosis or bactericidal activity. Neutrophils can also serve as host cell for various parasites that infect them avoiding phagocytosis, including:
Muscle architecture refers to the arrangement of muscle fibers relative to the axis of force generation, which runs from a muscle's origin to its insertion. The usual arrangements are types of parallel, and types of pennate muscle. In parallel muscles, the fascicles run parallel to the axis of force generation, but the fascicles can vary in their relationship to one another, and to their tendons. These variations are seen in fusiform, strap, and convergent muscles. A convergent muscle has a triangular or fan-shape as the fibers converge at its insertion and are fanned out broadly at the origin. A less common example of a parallel muscle is a circular muscle such as the orbicularis oculi, in which the fibers are longitudinally arranged, but create a circle from origin to insertion. These different architectures can cause variations in the tension that a muscle can create between its tendons. The fibers in pennate muscles run at an angle to the axis of force generation. This pennation angle reduces the effective force of any individual fiber, as it is effectively pulling off-axis. However, because of this angle, more fibers can be packed into the same muscle volume, increasing the physiological cross-sectional area (PCSA). This effect is known as fiber packing, and in terms of force generation, it more than overcomes the efficiency-loss of the off-axis orientation. The trade-off comes in overall speed of muscle shortening and in the total excursion. Overall muscle shortening speed is reduced compared to fiber shortening speed, as is the total distance of shortening.
Sources: en.wikipedia.org
It is a synthetic tetrapeptide. Its sequence was derived from research on peptide fractions of bovine pineal extract, and the intact AEDG sequence has not been demonstrated as an abundant free peptide in human tissue.
AEDG is the one-letter code for the four amino acids alanine, glutamate, aspartate and glycine in that order. The same molecule is written in three-letter form as Ala-Glu-Asp-Gly.
Identity is normally confirmed by mass spectrometry against the calculated mass of roughly 390.35 g/mol. Purity is then estimated by reversed-phase high-performance liquid chromatography with ultraviolet detection.
Epitalon is a synthetic tetrapeptide composed of four amino acids: alanine, glutamate, aspartate, and glycine. It is written as Ala-Glu-Asp-Gly. The free peptide has a molecular weight of about 390 daltons and is normally supplied as a lyophilized powder.